PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22641A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 1072aa    MW: 118401 Da    PI: 5.5902
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22641AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.62.5e-28597647252
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ek++sle+l+k+F++++k+AAk+Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Oropetium_20150105_22641A 597 EKTVSLEELRKHFAGSLKEAAKNLGVCPTTLKRICRQHGINRWPSRKIKKV 647
                                799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.473586667IPR003035RWP-RK domain
PfamPF020425.2E-26599647IPR003035RWP-RK domain
SuperFamilySSF542775.05E-21814904No hitNo description
Gene3DG3DSA:3.10.20.2403.0E-23815900No hitNo description
PROSITE profilePS5174519.498818901IPR000270PB1 domain
SMARTSM006661.7E-21818901IPR000270PB1 domain
PfamPF005641.1E-14819900IPR000270PB1 domain
CDDcd064078.45E-38819900No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1072 aa     Download sequence    Send to blast
MEPNEEDVML GCGGRMEEVV VGDMDLMDEL FLAAPGFDFS DFSQPGACAS PAAFSPLFDI  60
CSTTTTATPP PPQDDRDEPE KPDRAGDAGP PLRPWLFQPR QEVEAPVKDR LRRALERIAS  120
LSQSQPGELL AQVWVPTLIG GRQVLTTCGQ PFWLDRRNQR LASYRTVSMK YQFSADESSR  180
AELGLPGRVF VGRVPEWTPD VRYFSTEEYP RVHHAQHFDI RGSVALPIFE PKSRVCLGVV  240
ELVMTTQKVN YNAEIENICS ALKEVDLRST DVSRHPLTKV VDTSYRAVLP EIVDVLSTVC  300
ERHKLPLAQA WIPCACQAKR GSRHTDEKFK YCVSTVDEAC YVRDPSVRGF HQACSEHHLF  360
RGEGVVGKAF GTNEPCFSPD VTAYSKVQYP LSHHAKLFNL KAAVAIRLRS VRTGSLDFVL  420
EFFLPVDCVK DEEQREMLNS LSITIQQICY TLRVVSLKEV VNEGSIETSA LTPPEFYAKS  480
SNGNLDEICS SIDVPARTTS LETSEEVSSW IASLVDAQNK GVKEMDGDLP FGFSKQEDEG  540
FSVTAGWHTS PVLGPEDGIF SGFKQHEEYE VKEVNCSGRP SSLNLEKAGE KRRTKTEKTV  600
SLEELRKHFA GSLKEAAKNL GVCPTTLKRI CRQHGINRWP SRKIKKVGHS LKKLQMVIDS  660
VHGAEGTVQL SSLYENFTKT SWSEGELQGD ANYPWSDQKA HLEPSVPDQQ CEGRFTSHTS  720
GSNSLSPTCS QSSNSSHDCS SGSKSQQHAS PQQLAIKQEV CMEENQNFTI LKTSNNAELH  780
MLTEERPVTL SRPHSQMLLS EQKAIDNIPS IQNSKSDSLK VKAMYGEERC VFRLQPCWGF  840
NKLKEEIIRR FSIAKENYVD LKYLDDESEW VLLTCDADLV ECIDVYKSSS AQTVKILVNP  900
NVQPVLELKV FEQSTWSGGK QGDSTYIRLF QSECRNSGNF SSLFFMLSKG KGLDILERGD  960
DVVHGWPALG IAGEALVCEP GGPERSLGRV AAAEAPVHEA RQLPAAAAGA GEDRPRPLHQ  1020
VQLVARPGVL RTSAEVVTEM PASVPALQSA CTEIGTSEPA SLPVATYSGA A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698190.10.0PREDICTED: protein NLP1-like isoform X2
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLK4A5H90.0K4A5H9_SETIT; Uncharacterized protein
STRINGSi034133m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein